PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013611142.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 362aa    MW: 40522.1 Da    PI: 5.2376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013611142.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++  G+g +W + ++++g++R++k+c++rw++yl
   XP_013611142.1 14 KGPWSPEEDAKLKDYIENSGTGgNWIALPQKIGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.13.7e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
   XP_013611142.1  69 GGFSEEEDTIICNLYVTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.624962IPR017930Myb domain
SuperFamilySSF466891.08E-2511109IPR009057Homeodomain-like
SMARTSM007177.9E-111364IPR001005SANT/Myb domain
PfamPF002494.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-231569IPR009057Homeodomain-like
CDDcd001671.24E-71662No hitNo description
PROSITE profilePS5129420.84563117IPR017930Myb domain
SMARTSM007175.1E-1167115IPR001005SANT/Myb domain
PfamPF002491.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2370117IPR009057Homeodomain-like
CDDcd001671.20E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIE NSGTGGNWIA LPQKIGLRRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDTIIC NLYVTIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLNK  120
QRTEFQEARM KQEMVMMKRQ QQGHDHINGS TDLYLKNMFG SSPWPLLQQL PHHQVPLVMM  180
EPTSCNYYQT SPSCNLEQKP LITFNNMVKI EEEPEKTNPD HPQHQNSITN PFDVSVSQLL  240
LDPDYYLGSG GGGEGDFAIM SSSTNSPLPN TSGDQNEHQQ QEILQWFGSS NLQTEASSDM  300
FLNNIGNLET NEDTRFYSSL AGAGAAPAGG TTSTSADQST ISWEDITSLV NSEDASYFNG  360
PN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0629010.0AF062901.1 Arabidopsis thaliana putative transcription factor (MYB68) mRNA, complete cds.
GenBankAK2274720.0AK227472.1 Arabidopsis thaliana mRNA for transcription factor like protein, complete cds, clone: RAFL14-10-M08.
GenBankAY5196470.0AY519647.1 Arabidopsis thaliana MYB transcription factor (At5g65790) mRNA, complete cds.
GenBankBT0059940.0BT005994.1 Arabidopsis thaliana At5g65790 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611142.10.0PREDICTED: transcription factor RAX3-like
RefseqXP_013710046.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y91e-123RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0D3E2E00.0A0A0D3E2E0_BRAOL; Uncharacterized protein
STRINGBra024419.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.10.0myb domain protein 68